PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG004733t1
Common NameTCM_004733
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 193aa    MW: 22166.1 Da    PI: 8.696
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG004733t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.37e-13121179361
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                       +  re  k++NRe+A+r  ++Kka+i+eLe +v++L ++N  Lkk l   ++ +++l++
  Thecc1EG004733t1 121 AQMRELTKIRNRESASRAFAKKKAYIQELELEVQTLRKKNANLKKLLHLFSESCPSLDM 179
                       5668999*************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-5119183IPR004827Basic-leucine zipper domain
CDDcd147074.43E-14123177No hitNo description
PfamPF001704.0E-9124178IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-11124177No hitNo description
SuperFamilySSF579592.56E-8125174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MENEEDHKFS GQRIDFAQLL QDDEAFENVF FPPISMDYNP MNINEYIDFN ELHQLLNEEK  60
SAEGVQFDVR NEGGVNRGHG RNRVAFRINN GGLMNAERKV EENVKKQVTK KSCVKGSVEA  120
AQMRELTKIR NRESASRAFA KKKAYIQELE LEVQTLRKKN ANLKKLLHLF SESCPSLDMT  180
QKQLRRTTSG PM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051019.11e-141Uncharacterized protein TCM_004733
TrEMBLA0A061DSZ91e-141A0A061DSZ9_THECC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2810722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-07ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]